Cresta
Senior Software Engineer, Frontend (Platform)
2d ago
WorldwideSeniorRemotejavascriptreacttypescriptcsshtmlwebpackbabel
Senior frontend software engineer role focused on building and maintaining a robust platform for frontend development with emphasis on architecture, design patterns, and best practices.
Responsibilities
- Play a substantial role in the platform frontend engineering team.
- Work with Cresta product and engineering teams, build and continuously improve the Cresta platform and new product requirements.
- Stay closely with customers and their requirements, analyze the technical tradeoffs, own the customer facing deliverables.
- Develop high quality, well designed, reusable, and well-tested system components, and contribute to the overall system designs.
- Constantly identifies product improvement opportunities and generates product improvement ideas.
- Demonstrate the engineering best practices in deliverables and daily work. Uphold others to the same high standards.
- Technical ownership in a substantial part of the Cresta product and platform.
- Contribute to building the best-in-class company in addition to building the best-in-class product.
Requirements
- Bachelor’s degree in Computer Science or related field. Strong Computer Science fundamentals.
- 8+ years of experience in relevant domains.
- Very solid coding skills.
- Familiar with React or Angular. Have used at least one of them in large scale consumer-facing products.
- Proficient in designing and maintaining clear frontend architecture.
- Experience as a technical lead of frontend stack supporting various product features.
- We offer Cresta employees a variety of medical, dental, and vision plans, designed to fit you and your family’s needs
- Paid parental leave to support you and your family
- Monthly Health & Wellness allowance
- Work from home office stipend to help you succeed in a remote environment
- Lunch reimbursement for in-office employees
- PTO: 3 weeks in Canada
- Compensation for this position includes a base salary, equity, and a variety of benefits. Actual base salaries will be based on candidate-specific factors, including experience, skillset, and location, and local minimum pay requirements as applicable. We are actively hiring for this role in the US and Canada. Your recruiter can provide further details.
- We have noticed a rise in recruiting impersonations across the industry, where scammers attempt to access candidates' personal and financial information through fake interviews and offers. All Cresta recruiting email communications will always come from the @cresta.ai domain. Any outreach claiming to be from Cresta via other sources should be ignored. If you are uncertain whether you have been contacted by an official Cresta employee, reach out to recruiting@cresta.ai
Other
- Cresta unlocks the true potential of the customer experience, turning every conversation into a competitive advantage. Cresta’s unified AI platform combines conversational AI agents, real-time human agent augmentation, and comprehensive conversation intelligence to drive revenue and efficiency gains across every channel. The world’s leading companies, including United Airlines, Cox Communications, and Marriott, use Cresta to power world-class customer experiences every day.
- Born from the Stanford AI Lab, Cresta has raised more than $270 million from the world’s leading investors, including a16z, Greylock, and Sequoia. Cresta’s leadership includes some of the leading minds in AI today. Our CEO, Ping Wu , founded and led Google's Contact Center AI and Vertex AI platforms before joining Cresta to build the future of AI-driven customer experiences.
- Over the next few years, AI is going to redefine how people all over the world interact with businesses every day. Come build that future at Cresta.